PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10016245m
Common NameCARUB_v10016245mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 204aa    MW: 23242.4 Da    PI: 10.1903
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10016245mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.4e-162673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +l +++  +G g W+++a+  g++Rt+k+c++rw++yl
  Carubv10016245m 26 KGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 73
                     79********************************************97 PP

2Myb_DNA-binding56.66.1e-1879122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+++++++lG++ W++Ia++++ gRt++++k++w++
  Carubv10016245m  79 RGNITAEEQLLIIQLHAKLGNR-WSKIAKHLP-GRTDNEIKNFWRT 122
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8642173IPR017930Myb domain
SuperFamilySSF466892.24E-2924120IPR009057Homeodomain-like
SMARTSM007179.4E-122575IPR001005SANT/Myb domain
PfamPF002491.9E-142673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-212780IPR009057Homeodomain-like
CDDcd001671.54E-82873No hitNo description
PROSITE profilePS5129424.74974128IPR017930Myb domain
SMARTSM007172.1E-1678126IPR001005SANT/Myb domain
PfamPF002492.1E-1679122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-2581128IPR009057Homeodomain-like
CDDcd001671.07E-1283122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
METMKKKGRG KATITSQKEE EGTVRKGPWT MEEDFILFNY ILNHGEGLWN SVAKASGLKR  60
TGKSCRLRWL NYLRPDVRRG NITAEEQLLI IQLHAKLGNR WSKIAKHLPG RTDNEIKNFW  120
RTKIQRHMKV PPKNMMHQHC SGNSQSSGMT TTDQGSSGKA IDMAESFSPA TTTFNVVEQS  180
NENYWNVEDL WPVHLLNGDH HVI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-272612627126MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00324DAPTransfer from AT3G01530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1180910.0AK118091.1 Arabidopsis thaliana At3g01530 mRNA for putative transcription factor, complete cds, clone: RAFL19-34-G03.
GenBankBT0055740.0BT005574.1 Arabidopsis thaliana clone U50886 putative myb family transcription factor (At3g01530) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300020.11e-152hypothetical protein CARUB_v10016245mg
SwissprotQ9SSA11e-135MYB57_ARATH; Transcription factor MYB57
TrEMBLR0I8T71e-152R0I8T7_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0003_591e-138(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01530.11e-136myb domain protein 57